X
Email:
sales@ruixibiotech.com

Prokineticin 2 Isoform 2 (human) trifluoroacetate salt,CAS: 423206-00-2

Prokineticin 2 Isoform 2 (human) trifluoroacetate salt

Catalog # Pkg Size Price(USD) Quantity Buy this product
R-M-1140 0.1mg 215.00
- +
+ Add to cart
R-M-1140 0.5mg 895.00
- +
+ Add to cart
R-M-1140 1mg 1500.00
- +
+ Add to cart

Product description

Prokineticin 2 (Bv8) is one of the first neuropeptides that appears to directly convey circadian rhythm signaling to other CNS structures and, therefore, it may be a critical output molecule regulating biological rhythms. The peptide has the capacity to strongly suppress nocturnal locomotor activity. Prokineticin 2 transmits the behavioural circadian rhythm of the suprachiasmatic nucleus. The peptide binds to the G-protein-coupled receptor PKR2. Gardiner et al. showed that prokineticin 2 potently inhibits food intake.


Appearance N/A
Molecular weight N/A
Purity >90%
Solubility N/A
Cas 423206-00-2
Sequence AVITGACDKDSQCGGGMCCAVSIWVKSIRICTPMGKLGDSCHPLTRKVPFFGRRMHHTCPCLPGLACLRTSFNRFICLAQK
Synonyms Bv8
Molecular Formula  C₃₇₉H₆₀₆N₁₁₄O₁₀₁S₁₃
Storage -20℃, protected from light and moisture
Transportation 4-25℃ temperature for up to 3 weeks
Stability 1 year
Document

Related Product