Home > products > peptide
> synthetic-peptide
> prokineticin-2-isoform-2-human-trifluoroacetate-salt
Prokineticin 2 Isoform 2 (human) trifluoroacetate salt,CAS: 423206-00-2
Prokineticin 2 Isoform 2 (human) trifluoroacetate salt
Catalog # | Pkg Size | Price(USD) | Quantity | Buy this product |
---|---|---|---|---|
R-M-1140 | 0.1mg | 215.00 | + Add to cart |
|
R-M-1140 | 0.5mg | 895.00 | + Add to cart |
|
R-M-1140 | 1mg | 1500.00 | + Add to cart |
|
|
Product description
Prokineticin 2 (Bv8) is one of the first neuropeptides that appears to directly convey circadian rhythm signaling to other CNS structures and, therefore, it may be a critical output molecule regulating biological rhythms. The peptide has the capacity to strongly suppress nocturnal locomotor activity. Prokineticin 2 transmits the behavioural circadian rhythm of the suprachiasmatic nucleus. The peptide binds to the G-protein-coupled receptor PKR2. Gardiner et al. showed that prokineticin 2 potently inhibits food intake.
Appearance | N/A |
---|---|
Molecular weight | N/A |
Purity | >90% |
Solubility | N/A |
Cas | 423206-00-2 |
Sequence | AVITGACDKDSQCGGGMCCAVSIWVKSIRICTPMGKLGDSCHPLTRKVPFFGRRMHHTCPCLPGLACLRTSFNRFICLAQK |
Synonyms | Bv8 |
Molecular Formula | C₃₇₉H₆₀₆N₁₁₄O₁₀₁S₁₃ |
Storage | -20℃, protected from light and moisture |
Transportation | 4-25℃ temperature for up to 3 weeks |
Stability | 1 year |
Document
Related Product