Home > products  >  peptide
					>  synthetic-peptide
					>  prokineticin-2-isoform-2-human-trifluoroacetate-salt
				
				Prokineticin 2 Isoform 2 (human) trifluoroacetate salt,CAS: 423206-00-2
 Prokineticin 2 Isoform 2 (human) trifluoroacetate salt
Prokineticin 2 Isoform 2 (human) trifluoroacetate salt
						| Catalog # | Pkg Size | Price(USD) | Quantity | Buy this product | 
|---|---|---|---|---|
| R-M-1140 | 0.1mg | 215.00 | + Add to cart | |
| R-M-1140 | 0.5mg | 895.00 | + Add to cart | |
| R-M-1140 | 1mg | 1500.00 | + Add to cart | |
|  | ||||
Product description
							Prokineticin 2 (Bv8) is one of the first neuropeptides that appears to directly convey circadian rhythm signaling to other CNS structures and, therefore, it may be a critical output molecule regulating biological rhythms. The peptide has the capacity to strongly suppress nocturnal locomotor activity. Prokineticin 2 transmits the behavioural circadian rhythm of the suprachiasmatic nucleus. The peptide binds to the G-protein-coupled receptor PKR2. Gardiner et al. showed that prokineticin 2 potently inhibits food intake.
| Appearance | N/A | 
|---|---|
| Molecular weight | N/A | 
| Purity | >90% | 
| Solubility | N/A | 
| Cas | 423206-00-2 | 
| Sequence | AVITGACDKDSQCGGGMCCAVSIWVKSIRICTPMGKLGDSCHPLTRKVPFFGRRMHHTCPCLPGLACLRTSFNRFICLAQK | 
| Synonyms | Bv8 | 
| Molecular Formula | C₃₇₉H₆₀₆N₁₁₄O₁₀₁S₁₃ | 
| Storage | -20℃, protected from light and moisture | 
| Transportation | 4-25℃ temperature for up to 3 weeks | 
| Stability | 1 year | 
Document
							Related Product
							
						
 Items-$0.00
Items-$0.00

 Email:
Email: Tel.:
Tel.: msds      of    Prokineticin 2 Isoform 2 (human) trifluoroacetate salt
msds      of    Prokineticin 2 Isoform 2 (human) trifluoroacetate salt  RuixiBiotechCo.Ltd /KamulinBiotechco.ltd
                    RuixiBiotechCo.Ltd /KamulinBiotechco.ltd
                 Add: Room 20F 2002, Meiyuan Building, Yanta District, Xi’ an City, Shaanxi Province 710061 China
                    Add: Room 20F 2002, Meiyuan Building, Yanta District, Xi’ an City, Shaanxi Province 710061 China 
                 Tel:  02988811435
                    Tel:  02988811435
                 Fax: (86-29)8881-1435
                    Fax: (86-29)8881-1435
                 Email: sales@ruixibiotech.com
                    Email: sales@ruixibiotech.com
                 Web: http://www.ruixibiotech.com
                    Web: http://www.ruixibiotech.com    
					
							
                

